Not available outside of the UK & Ireland.
Biochem/physiol Actions
SAMSN1 (SAM domain, SH3 domain, and nuclear localization signals 1), also known as HACS1/SLY2/NASH1, is a member of a family of three adapter proteins that are highly homologous and characterized by the presence of protein-protein interaction domains. The SAMSN1 gene localizes to the 21q11.2 region on human chromosome 21. The transcript of SAMSN1 has been found in acute myeloid leukemia, lymphoma, and multiple myeloma cell-lines.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human SAMSN1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGY
This product has met the following criteria to qualify for the following awards: