Anti-CRELD1

Code: AV45004-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-CRELD1 polyclonal antibody is used to tag cysteine-rich with EGF-like domains 1 proteins for detection and quantitation by Western blotting and in cells and ...


 Read more

Your Price
$456.36 100UL

Not available outside of the UK & Ireland.

Application

Anti-CRELD1 polyclonal antibody is used to tag cysteine-rich with EGF-like domains 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cysteine-rich with EGF-like domains 1 in cardiac diseases such as AVSD and CDH.

Biochem/physiol Actions

Epidermal growth factor (EGF; MIM 131530)-like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Cysteine-rich with EGF-like domains 1 (CRELD1), a highly conserved membrane bound extracellular protein that defines a new epidermal growth factor-related gene family, is a cell adhesion molecule associated with cardiac atrioventricular septal defects (AVSD) and congenital heart disease (CHD).

Immunogen

Synthetic peptide directed towards the C terminal region of human CRELD1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE

Specificity

Anti-CRELD1 polyclonal antibody detects canine, human, bovine, mouse, and and rat cysteine-rich with EGF-like domains 1 proteins.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CRELD1(78987)
mol wt45 kDa
NCBI accession no.NP_001070883
Quality Level100
shipped inwet ice
species reactivitydog, human, horse, bovine, guinea pig
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q96HD1
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.