Anti-PPIB

Code: av44365-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Immunohistochemistry (1 paper)

Anti...


 En savoir plus

Votre prix
$402.51 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Immunohistochemistry (1 paper)

Anti-PPIB (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5.0µg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8µg/ml.

Biochem/physiol Actions

Peptidylprolyl isomerase B (PPIB; cyclophilin B) is a protein released with secretory pathway in the biological fluids by the rough endoplasmic reticulum. It is involved in the regulation of cyclosporine A-mediated immunosuppression. Mutations in the PPIB gene cause a delay in procollagen chain association in osteoblasts that is one of the features of osteogenesis imperfecta phenotypes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human PPIB

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PPIB(5479)
mol wt24 kDa
NCBI accession no.NP_000933
Quality Level100
shipped inwet ice
species reactivitymouse, rabbit, human, guinea pig, dog
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.A8K534
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.