Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti-PTCH1 antibody produced in rabbit has been used in Flow cytometry/Cell sorting. It is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Flow cytometry/Cell sorting (1 paper)
Biochem/physiol Actions
Mutations in protein patched homolog 1(PTCH1) is implicated in autosomal dominant disorder called the Gorlin syndrome, resulting in developmental abnormalities.
PTCH1 (patched 1; PTC) activates the sonic hedgehog (Hh) signaling pathway that is involved in the development of embryonic structures. PTCH1 is a tumor suppressor that maintains the activity of GLI1, the downstream target of Hh signaling. Mutations and methylation status in PTCH1 gene result in tumorigenesis and malignancy in cancers including colorectal, gastric, melanoma and osteosarcoma.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Protein patched homolog 1 (PTCH1) is the receptor for secreted sonic hedgehog ligand and belongs to the patched gene family. It is mapped to human chromosome 9q22.32. Ptch1 has 12 transmembrane regions, intracellular middle-loop domain (MLD) and C-terminal domain (CTD) essential for oligomerization.
Immunogen
Synthetic peptide directed towards the C terminal region of human PTCH1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :