Anti-PTBP1

Code: AV40421-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Polypyrimidine tract-binding protein 1 (PTBP1) plays a key role in T cell activation, spermatogenesis, and splicing. It is involved in the differentia...


 Read more

Your Price
$517.56 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

Polypyrimidine tract-binding protein 1 (PTBP1) plays a key role in T cell activation, spermatogenesis, and splicing. It is involved in the differentiation and development of neuronal cells, growth of embryos and erythrocytes. PTBP1 also participates in apoptosis, glycolysis, migration, metastasis, proliferation, and carcinogenesis due to its role in cancer as a splicing factor. This protein plays a major role in neurodegenerative diseases, cardiovascular diseases, colon cancer, colorectal cancer, breast cancer, glioma, and glioblastoma.

The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. PTBP1 protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. Alternatively spliced transcript variants encoding different isoforms have been described.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Polypyrimidine tract-binding protein 1 (PTBP1) is a member of the ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs) subfamily. It has an N-terminal nuclear shuttling domain and four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. PTBP1 is mostly expressed in all cell types. The PTBP1 gene is mapped on human chromosome 19p13.3.

Immunogen

Synthetic peptide directed towards the N terminal region of human PTBP1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PTBP1(5725)
mol wt58 kDa
NCBI accession no.NP_114367
Quality Level100
shipped inwet ice
species reactivityguinea pig, mouse, bovine, horse, human, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P26599
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.