Anti-ACO1

Code: AV40390-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-Aconitase-1 antibody is a rabbit IgG polyclonal antibody used to tag Aconitase-1 protein(s) for detection and quantitation by Western blotting and in cells a...


 Read more

Your Price
$459.05 100UL

Not available outside of the UK & Ireland.

Application

Anti-Aconitase-1 antibody is a rabbit IgG polyclonal antibody used to tag Aconitase-1 protein(s) for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques.

Biochem/physiol Actions

ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5′ UTR of ferritin mRNA, and in the 3′ UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Aconitase-1 is a soluble/cytoplasmin, non-mitochondrial enzyme that catalyzes the stereo-specific isomerization of citrate to isocitrate.

Immunogen

Synthetic peptide directed towards the N terminal region of human ACO1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC

Specificity

Anti-Aconitase-1 antibody recognizes human aconitase-1.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... ACO1(48)
mol wt98 kDa
NCBI accession no.NP_002188
Quality Level100
shipped inwet ice
species reactivityhuman, rat, bovine, pig
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P28271
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.