Anti-EIF4B

Code: AV40359-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

IF4B contains 1 RRM (RNA recognition motif) domain and is required for the binding of mRNA to ribosomes. Functions of EIF4B are in close association w...


 Read more

Your Price
$456.36 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

IF4B contains 1 RRM (RNA recognition motif) domain and is required for the binding of mRNA to ribosomes. Functions of EIF4B are in close association with EEF4-F and EIF4-A. It binds near the 5′-terminal cap of mRNA in presence of EIF-4F and ATP and promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the C terminal region of human EIF4B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: NPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQ

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... EIF4B(1975)
mol wt67 kDa
NCBI accession no.NP_001408
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P23588
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.