Not available outside of the UK & Ireland.
Biochem/physiol Actions
NR1H3 belongs to the NR1 subfamily of nuclear receptor superfamily. The NR1 members regulate transcription that is required in lipid homeostasis and inflammation. NR1H3 is also known as LXRα is highly expressed in liver, kidney and intestine. LXRs act as cholesterol sensors and protect the cells from cholesterol overload.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human NR1H3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSA
This product has met the following criteria to qualify for the following awards: