Anti-TFAP2C

Code: AV38284-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-TFAP2C polyclonal antibody is used to tag transcription factor AP-2 gamma for detection and quantitation by Western blotting and in plasma by immunohistochem...


 Read more

Your Price
$456.36 100UL

Not available outside of the UK & Ireland.

Application

Anti-TFAP2C polyclonal antibody is used to tag transcription factor AP-2 gamma for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transcription factor AP-2 gamma in extra-embryonic membrane development during embryo gestation.

Biochem/physiol Actions

TFAP2C is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.The protein encoded by this gene is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The encoded protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The AP2 family of transcription factors is expressed during mammalian development, morphogenesis and in various malignancies. Transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma) (TFAP2G, AP2gamma, ERF1, TFAP2G, AP2-gamma) is a retinoic acid-responsive gene involved in placental development and the progression of human breast cancer. AP2-gamma is required for development and maintenance of extra-embryonic membranes, trophectoderm.

Immunogen

Synthetic peptide directed towards the N terminal region of human TFAP2C

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG

Specificity

Anti-TFAP2C polyclonal antibody reacts with human, mouse, rat, bovine, canine, zebrafish, pig, and chicken transcription factor AP-2 gamma proteins.

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TFAP2C(7022)
mol wt49 kDa
NCBI accession no.NP_003213
Quality Level100
shipped inwet ice
species reactivityrabbit, dog, rat, pig, human, mouse, bovine
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q92754
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.