Anti-CLIC5

Code: AV35263-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-CLIC5 antibody is suitable for western blot (0.25 µg/ml) and IHC (4-8 µg/ml) applications.

Biochem/physiol Actions

 Read more

Your Price
$682.52 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-CLIC5 antibody is suitable for western blot (0.25 µg/ml) and IHC (4-8 µg/ml) applications.

Biochem/physiol Actions

Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CLIC5 is a chloride intracellular channel protein involved in hair cell stereocilia formation. It reportedly stabilizes membrane-actin filament links at the base of stereocilia. It has a role in the growth and differentiation of C2C12 myoblasts.Rabbit Anti-CLIC5 antibody recognizes human, mouse, rat, pig, zebrafish, chicken, canine, and bovine CLIC5.

Immunogen

Synthetic peptide directed towards the C terminal region of human CLIC5

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CLIC5(53405)
mol wt28 kDa
NCBI accession no.NP_001107558
Quality Level100
shipped inwet ice
species reactivityhorse, guinea pig, bovine, human, rat, rabbit
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q53G01
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.