Not available outside of the UK & Ireland.
Application
Rabbit Anti-CHRNA5 antibody is suitable for western blot applications at a concentration of 1 µg/ml.
Biochem/physiol Actions
Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
CHRNA5 codes for a subunit of the nicotinic acetylcholine receptor. Variations in this gene have been linked to the risk of nicotine and alcohol dependence, as well as lung cancer.Rabbit Anti-CHRNA5 antibody recognizes zebrafish, canine, bovine, mouse, chicken, rat, and human CHRNA5.
Immunogen
Synthetic peptide directed towards the middle region of human CHRNA5
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS
This product has met the following criteria to qualify for the following awards: