Not available outside of the UK & Ireland.
Application
Rabbit Anti-HSF2BP antibody is suitable for western blot (1.25 µg/ml) and IHC (4-8 µg/ml).
Biochem/physiol Actions
HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
HSF2BP codes for a protein that binds to heat shock transcription factor 2 (HSF2) and may regulate HSF2 activity. Studies have reported that HSF2BP represses the transcriptional functions of BNC1.Rabbit Anti-HSF2BP antibody recognizes bovine, canine, human, mouse, and rat HSF2BP.
Immunogen
Synthetic peptide directed towards the N terminal region of human HSF2BP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVE
This product has met the following criteria to qualify for the following awards: