Anti Uhrf2 Antibody Produced In Rabbit

Code: AV34772-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-UHRF2 antibody is suitable for western blot applications at a concentration of 0.5 µg/ml and for IHC (4-8 µg/ml).

Biochem/phys...


 Read more

Your Price
$611.17 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-UHRF2 antibody is suitable for western blot applications at a concentration of 0.5 µg/ml and for IHC (4-8 µg/ml).

Biochem/physiol Actions

UHRF2 encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

UHRF2 is a ubiquitin E3 ligase that also functions as a SUMO E3 ligase for ZNF131. This E3 ligase has been implicated in the cell cycle network.Rabbit Anti-UHRF2 antibody recognizes human, bovine, rat, canine, and mouse UHRF2.

Immunogen

Synthetic peptide directed towards the N terminal region of human UHRF2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... UHRF2(115426)
mol wt90 kDa
NCBI accession no.NP_690856
Quality Level100
shipped inwet ice
species reactivityrabbit, human
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q96PU4
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.