Anti-MEIS2

Code: AV34684-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-MEIS2 antibody is suitable for western blot (1.25 µg/ml) and IHC (4-8 µg/ml) applications.

Biochem/physiol Actions

 Read more

Your Price
$456.36 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-MEIS2 antibody is suitable for western blot (1.25 µg/ml) and IHC (4-8 µg/ml) applications.

Biochem/physiol Actions

MEIS2 encodes a homeobox protein belonging to the TALE (′three amino acid loop extension′) family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

MEIS2 is a homeobox protein that is involved in the development of lens and retina. It is also known to compete with Tle4 for Otx2 binding and modulates tectal fate.Rabbit Anti-MEIS2 antibody recognizes chicken, human, mouse, rat, zebrafish, canine, and bovine MEIS2.

Immunogen

Synthetic peptide directed towards the N terminal region of human MEIS2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: HYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELA

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MEIS2(4212)
mol wt52 kDa
NCBI accession no.NP_002390
Quality Level100
shipped inwet ice
species reactivityrat, rabbit, dog, mouse, guinea pig, horse, human, bovine
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.O14770
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.