Anti-KLHL14

Code: AV34677-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit anti-KLHL14 antibody is suitable for western blot assays and for IHC assays at 4-8 μg/ml.

Biochem/physiol Actions

KLHL14 is a ...


 Read more

Your Price
$378.28 100UL

Not available outside of the UK & Ireland.

Application

Rabbit anti-KLHL14 antibody is suitable for western blot assays and for IHC assays at 4-8 μg/ml.

Biochem/physiol Actions

KLHL14 is a member of the KLHL family.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

KLHL14 is a protein member of the kelch-like family. Rabbit anti-KLHL14 antibody recognizes chicken, canine, bovine, human, mouse, and rat KLHL14.

Immunogen

Synthetic peptide directed towards the N terminal region of human KLHL14

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... KLHL14(57565)
mol wt71 kDa
NCBI accession no.NP_065856
Quality Level100
shipped inwet ice
species reactivityguinea pig, bovine, dog, human, rabbit, rat, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8WU41
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.