Not available outside of the UK & Ireland.
Biochem/physiol Actions
The protein encoded by RNF135 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is located in a chromosomal region known to be frequently deleted in patients with neurofibromatosis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
RING finger protein 135 (RNF135/Riplet/REUL) contains the protein-protein binding motif, RING. It was shown to function as an E3 ubiquitin ligase involved in detection and control of viral transfection. Mutations in this gene are associated with new overgrowth syndrome and neurofibromatosis.
Immunogen
Synthetic peptide directed towards the middle region of human RNF135
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DILHDLEEIQEKLQESVTWKEAPEAQMQGELLEAPSSSSCPLPDQSHPAL
This product has met the following criteria to qualify for the following awards: