Not available outside of the UK & Ireland.
Application
Rabbit Anti-KLHL25 antibody is suitable for western blot applications at a concentration of 2 µg/ml.
Biochem/physiol Actions
KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
KLHL25 is a kelch-like family member that complexes with CUL3 to form E3 ubiquitin ligase complex. This complex is known to target hypophosphorylated 4E-BP1.Rabbit Anti-KLHL25 antibody recognizes canine, human, mouse, and rat KLHL25.
Immunogen
Synthetic peptide directed towards the N terminal region of human KLHL25
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA
This product has met the following criteria to qualify for the following awards: