Anti-SOX17

Code: AV33271-100UL D2-231

Not available outside of the UK & Ireland.

Biochem/physiol Actions

The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development a...


 Read more

Your Price
$459.05 100UL

Not available outside of the UK & Ireland.

Biochem/physiol Actions

The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SRY-box (SOX) transcription factors bind the minor groove of DNA to modulate gene expression. SRY-box 17 (SOX17) regulates a variety of developmental processes such as endoderm formation. SOX17 is an antagonist to Wnt/β-catenin pathway cell signaling. SOX17 is a potential biomarker for breast cancer carcinogenesis and progression.

Immunogen

Synthetic peptide directed towards the C terminal region of human SOX17

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GTDPSQPAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGA

Specificity

Rabbit polyclonal anti-SOX17 antibody reacts with canine, human, and pig SRY (sex determining region Y)-box 17 transcription factors.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SOX17(64321)
mol wt44 kDa
NCBI accession no.NP_071899
Quality Level100
shipped inwet ice
species reactivitypig, dog, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9H6I2
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.