Not available outside of the UK & Ireland.
Application
Rabbit polyclonal anti-CCNL1 antibody is used to tag cyclin-L1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of cyclin-L1 in RNA elongation and processing, and alternative splicing. Cyclin-L1 is also a potential oncogene with a role in human head and neck squamous cell carcinomas (HNSCC) and breast cancer.
Biochem/physiol Actions
CCNL1 plays a critical role in the loco-regional progression of HNSCC and may serve as an indicator for occult advanced tumour stages. CCNL1 also plays a role in pre-mRNA splicing, has been shown to associate with the PITSLRE kinase, and is involved in pre-mRNA processing.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Cyclin L (ania-6a) is an RNA polymerase II-associated cyclin that interacts with key elements of the RNA elongation/processing complex such as the splicing factor SC-35. It is involved in pre-mRNA processing and the regulation of alternative RNA splicing regulation. Cyclin L1 has been linked to the loco-regional progression of human head and neck squamous cell carcinomas (HNSCC) and breast cancer.
Immunogen
Synthetic peptide directed towards the N terminal region of human CCNL1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETD
Specificity
Rabbit polyclonal anti-CCNL1 antibody reacts with human, mouse, rat, and bovine clyclin-L1 proteins.
This product has met the following criteria to qualify for the following awards: