Not available outside of the UK & Ireland.
Application
Rabbit polyclonal anti-SUV39H1 antibody is used to tag suppressor of variegation 3-9 homolog 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of suppressor of variegation 3-9 homolog 1 in the regulation of chromatin organization and chromosome segregation and as a regulator or cancer progression via E-cadherin-dependent epithelial-mesenchymal transition (EMT).
Rabbit Anti-SUV39H1 antibody can be used for western blot applications at a concentration of 1.25µg/ml.
Biochem/physiol Actions
SUV39H1, a human homolog of the Drosophila position effect variegation modifier Su(var)3-9 and of the S. pombe silencing factor clr4, encodes a heterochromatic protein that transiently accumulates at centromeric positions during mitosis.This gene is a member of the suppressor of variegation 3-9 homolog family and encodes a protein with a chromodomain and a C-terminal SET domain. This nuclear protein moves to the centromeres during mitosis and functions as a histone methyltransferase, methylating Lys-9 of histone H3. Overall, it plays a vital role in heterochromatin organization, chromosome segregation, and mitotic progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Suppressor of variegation 3-9 homolog 1 (SUV39H1, KMT1A, MG44) is a histone-lysine N-methyltransferase that methylates lys-9 of histone H3. SUV39H1 is involved in heterochromatin organization, chromosome segregation, and mitotic progression. SUV39H1 generates a gradient of methylation marks at the kinetochore to spatiotemporally direct accurate chromosome segregation in mitosis. Suv39H1 interacts with Snail to mediated E-cadherin, a hallmark of epithelial-mesenchymal transition (EMT), repression in breast cancer.
Rabbit polyclonal anti-SUV39H1 antibody reacts with human, mouse, rat, zebrafish, bovine, and canine suppressor of variegation 3-9 homolog 1 enzymes.
Immunogen
Synthetic peptide directed towards the C terminal region of human SUV39H1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
This product has met the following criteria to qualify for the following awards: