Anti-PBX3

Code: AV32070-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-PBX3 antibody can be used for western blot applications at a concentration of 2.5µg/ml.

Biochem/physiol Actions

PBX3...


 Read more

Your Price
$456.36 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-PBX3 antibody can be used for western blot applications at a concentration of 2.5µg/ml.

Biochem/physiol Actions

PBX3 is a transcriptional activator that binds the sequence 5′-ATCAATCAA-3′.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

PBX3 is a homeobox transcription factor that shares homology with the human proto-oncogene, PBX1. It is known to enhance the transcriptional functions of HOX proteins and can also modulate developmental genes. Furthermore, PBX1 can regulate cell proliferation and has been implicated in gastric cancer.Rabbit Anti-PBX3 antibody recognizes human, mouse, rat, bovine, chicken, and zebrafish PBX3.

Immunogen

Synthetic peptide directed towards the N terminal region of human PBX3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIM

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... PBX3(5090)
mol wt47 kDa
NCBI accession no.NP_006186
Quality Level100
shipped inwet ice
species reactivitymouse, rat, human, bovine, guinea pig
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.P40426
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.