Not available outside of the UK & Ireland.
Application
Rabbit Anti-LASS3 antibody can be used for western blot applications at a concentration of 0.5µg/ml.
Biochem/physiol Actions
The gene encoding the hypothetical protein LASS3 is located on chromosome 15.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Longevity assurance homologue 3 (LASS3) is a testis-specific (dihyrdo)ceramide synthase that acts on a broad range of substrates. LASS3 is known to have two transcriptional variants, comprising of a 384-amino acid protein and a 419-amino acid protein.Rabbit Anti-LASS3 antibody recognizes zebrafish, chicken, human, mouse, rat, bovine, and canine LASS3.
Immunogen
Synthetic peptide directed towards the N terminal region of human LASS3
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA
This product has met the following criteria to qualify for the following awards: