Anti-SUPT16H

Code: AV31526-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit Anti-SUPT16H antibody can be used for western blot assays at a concentration of 1.25µg/ml.

Biochem/physiol Actions

Transc...


 Read more

Your Price
$402.51 100UL

Not available outside of the UK & Ireland.

Application

Rabbit Anti-SUPT16H antibody can be used for western blot assays at a concentration of 1.25µg/ml.

Biochem/physiol Actions

Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit, the latter of which is SUPT16H.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SUPT16H is a transcription factor that interacts with RNF40. This transcription factor mediates structural changes in chromatin during DNA double strand repair.Rabbit Anti-SUPT16H antibody recognizes bovine, rat, human, zebrafish, mouse, and canine SUPT16H.

Immunogen

Synthetic peptide directed towards the N terminal region of human SUPT16H

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIK

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SUPT16H(11198)
mol wt66 kDa
NCBI accession no.NP_009123
Quality Level100
shipped inwet ice
species reactivityhorse, dog, rabbit, rat, pig, human
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9Y5B9
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.