Anti-GLIS2

Code: AV30037-100UL D2-231

Not available outside of the UK & Ireland.

Application

Rabbit polyclonal anti-GLIS2 antibody is used to tag GLIS family zinc finger 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) ...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Rabbit polyclonal anti-GLIS2 antibody is used to tag GLIS family zinc finger 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of GLIS family zinc finger 2 in kidney development and maintenance. Anti-GLIS2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 µg/ml.

Biochem/physiol Actions

Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Rabbit polyclonal anti-GLIS2 antibody reacts with canine, human, chicken, rat, bovine, and mouse GLIS family zinc finger 2 transcription factors.

GLIS family zinc finger 2 (GLIS2), a Krüppel-like zinc finger protein family member with transactivation and repressor functions, is involved in kidney development, the maintenance of normal renal function and neurogenesis. Glis2 interacts with β-catenin and may function as a negative modulator of β-catenin/TCF-mediated transcription. Defective GLIS2 has been linked to the development of nephronophthisis.

Immunogen

Synthetic peptide directed towards the N terminal region of human GLIS2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GLIS2(84662)
mol wt56 kDa
NCBI accession no.NP_115964
Quality Level100
shipped inwet ice
species reactivityhorse, dog, rat, human, bovine, guinea pig
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9BZE0
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.