Anti-HES7

Code: AV30035-100UL D2-231

Not available outside of the UK & Ireland.

Application

Anti-HES7 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml. For immunohistochemistry of paraffin-embedded tissue se...


 Read more

Your Price
$611.17 100UL

Not available outside of the UK & Ireland.

Application

Anti-HES7 antibody produced in rabbit is suitable for western blotting at a concentration of 1 µg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 µg/ml is suitable.

Biochem/physiol Actions

Hes7 is a bHLH factor that is essential for somitogenesis and regulation of segmentation clock in collaboration with Notch signaling.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human HES7

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VGYLRERSRVEPPGVPRSPVQDAKALASCYLSGFRECLLRLAAIAHDASP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... HES7(84667)
mol wt25 kDa
NCBI accession no.NP_115969
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9BYE0
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.