Not available outside of the UK & Ireland.
Application
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Western Blotting (1 paper)
Anti-CCNG2 antibody is suitable for western blotting at a concentration of 2.5 µg/ml.
Biochem/physiol Actions
Cyclin G2 is an unconventional cyclin protein that shuttles between nucleus and cytoplasm and is linked to growth inhibition and cell differentiation. Overexpression of CyclinG2 results in p53-dependent arrest of cell cycle in G1/S phase. It enforces G2/M cell cycle arrest in collaboration with DNA damage checkpoint signaling.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the N terminal region of human CCNG2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT
This product has met the following criteria to qualify for the following awards: