Not available outside of the UK & Ireland.
Application
Immunoblotting (4 µg/ml, chemiluminescence)r>Immunocytochemistry (1:1000)r>Immunoprecipitation (20 µg/ml)
General description
Protein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.
Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.
Recognizes the ~32 kDa HO-1 protein.
Immunogen
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
Human
Legal Information
CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany
Other Notes
Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.Maines, M.D. 1988. FASEB J.2, 2557.Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.
Packaging
200 µg in Plastic ampoule
Please refer to vial label for lot-specific concentration.
Physical form
In PBS, 50% glycerol.
Reconstitution
Following initial thaw, aliquot and freeze (-20°C).
Warning
Toxicity: Standard Handling (A)
This product has met the following criteria to qualify for the following awards: