Anti-EGFR (rabbit polyclonal IgG)

Code: 06-847-25UG D2-231

Not available outside of the UK & Ireland.

Analysis Note

ControlA431 cell lysate, human cervical carcinoma.

Included Positive Antigen Control:
Catalog # 12-305, 3T3/A31 Cell Lysate. Add 2.5 µL of...


 Read more

Your Price
$212.70 25UG

Not available outside of the UK & Ireland.

Analysis Note

ControlA431 cell lysate, human cervical carcinoma.

Included Positive Antigen Control:
Catalog # 12-305, 3T3/A31 Cell Lysate. Add 2.5 µL of 2-mercaptoethanol/100 µL of lysate and boil for 5 minutes to reduce the preparation. Load 20 µg of reduced lysate per lane for minigels.

Application

Immunoprecipitation:
4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:500 Dilution of this antibody detected EGFR in human placenta tissue sections.

Anti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB.

General description

The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs.

Immunogen

Ovalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence.

Legal Information

UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany

Linkage

Replaces: 04-337; 04-338

Other Notes

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Physical form

Format: Purified

Purified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.

Quality

Routinely evaluated by western blot on a mouse 3T3/A31 RIPA cell lysate.

Western Blot Analysis:
0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate.

Specificity

Reported to detect rat and hamster.

Recognizes the EGFR, Mr 180 kDa.

Storage and Stability

Stable for 1 year at 2-8°C from date of receipt.

Handling Recommendations: Upon first thaw,
and prior to removing the cap, centrifuge the
vial and gently mix the solution.

Target description

180 kDa

antibody formpurified immunoglobulin
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
Gene Informationhamster ... Egfr(100774580)human ... EGFR(1956)mouse ... Egfr(13649)rat ... Egf(25313)
isotypeIgG
manufacturer/tradenameUpstate®
NCBI accession no.NP_005219
packagingantibody small pack of 25 µg
Quality Level100
shipped inambient
species reactivityhamster, rat, mouse, human
technique(s)western blot: suitable, immunoprecipitation (IP): suitable
UniProt accession no.P00533
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.