Not available outside of the UK & Ireland.
Biochem/physiol Actions
The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
Reconstitution
Reconstitute in 25 mM Tris-HCl, pH 7.5 solution to a final concentration of 1mg/mL.
Sequence
[protein fragment, 39 aa]
Storage and Stability
Store diluted product in aliquots at -20°C. Avoid freeze/thaw cycles.
This product has met the following criteria to qualify for the following awards: