Calmodulin bovine, réactif, exprimé en E. coli, poudre lyophilisée ,> = 98% (SDS- PAGE)

Code: C4874-2MG D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Calmodulin bovine has been used inin vitro phosphorylation assay of recombinant retinoic acid-inducible gene I protein. It has also been used in the endoprotease ...


 En savoir plus

Votre prix
$964.32 2MG

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Calmodulin bovine has been used inin vitro phosphorylation assay of recombinant retinoic acid-inducible gene I protein. It has also been used in the endoprotease Glu-C proteolysis and deamidation studies.

Biochem/physiol Actions

Ca2+ binding protein that is required for activation of cyclic nucleotide-dependent phosphodiesterase. It is also a cofactor/activator of nitric oxide synthase, calcineurin, and many kinases including ATPase, myosin light chain kinase, and CAM kinase I, II, and III. It mediates ryanodine receptor activation by cyclic ADP-ribose and is involved in intracellular Ca2+ homeostasis.

Calmodulin from bovine undergoes conformational changes upon calcium binding. It binds to sphingosylphosphorylcholine and inhibit calcineurin and phosphodiesterase enzymes.

General description

Calmodulin from bovine takes up a dumb-bell-structure. Two calciumbinding EF hand loops, antiparallel β-sheet and three α-helices comprises a lobe. It has a central helix connecting the lobes. Calmodulin can bind four calcium molecules in a cooperative interaction pattern.

Physical properties

Sequence:MGSSHHHHHHSSGLVPRGSHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Preparation Note

Produced using animal component-free materials.

assay≥98% (SDS-PAGE)
biological sourcebovine
compositionProtein, ≥85%
formlyophilized powder
Gene Informationbovine ... CALM(100297344)
mol wtMw 19000.9 by amino acid sequence
Quality Level200
recombinantexpressed in E. coli
storage temp.−20°C
UniProt accession no.P62157
Cas Number77107-46-1
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.