PSF-OXB20-COOH-GST - C-TERMINAL GST TAG BACTERIAL PLASMID; plasmid vector for molecular cloning

Code: ogs3182-5ug D2-231

Not available outside of the UK & Ireland.

Analysis Note

To view the Certificate of Analysis for this product, please visit www.oxgene.com

General description

This plasmid is designed to e...


read more

Your Price
$377.00 5UG
Discontinued

Not available outside of the UK & Ireland.

Analysis Note

To view the Certificate of Analysis for this product, please visit www.oxgene.com

General description

This plasmid is designed to express tagged proteins in E. coli. The plasmid contains a constitutive promoter (OXB20) derived from the region upstream of the E. coli RecA gene. It does not require induction or any additional components for activity. It is the strongest of the bacterial promoters that we provide and this high level of expression can cause expression problems with some proteins with poor solubility. For this reason we sell a range of bacterial promoters with different expression levels (OXB1(low)>OXB20(high)) that can be provided with the peptide tags in this plasmid on request. About the Peptide Tag:This plasmid contains a c-terminal Glutathione-S-Transferase (GST) reporter tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is:SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS. About the Cleavage Tag:This plasmid does not contain a protease cleavage site. Promoter Expression Level: This plasmid contains a constitutive bacterial promoter that does not require induction. It is the strongest bacterial promoter we sell and this can cause solubility and expression problems with some proteins. We also offer a range of other bacterial promoters that are compatible with this plasmid and are available on request.

Sequence

To view sequence information for this product, please visit the product page

bacteria selectionkanamycin
formbuffered aqueous solution
mol wtsize 4508 bp
origin of replicationpUC (500 copies)
peptide cleavageno cleavage
peptide tag locationC-terminal
promoterPromoter name: OXB20Promoter activity: constitutivePromoter type: bacterial
recombinantexpressed in E. coli
reporter genenone
shipped inambient
storage temp.−20°C
tagGST tagged
This product has met the following criteria to qualify for the following awards:



PROCEED TO CHECKOUT

HAVE AN ACCOUNT? LOGIN


GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.