Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti-IMPDH2 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.
Biochem/physiol Actions
IMPDH2 gene encodes the rate-limiting enzyme inosine monophosphate dehydrogenase 2. It consists of 14 exons and is approximately 5.8kb in length. It is localised in the cytoplasm and nucleus. It plays a pivotal role in catalysing the NAD-dependent oxidation of inosine-5′-monophosphate into xanthine-5′-monophosphate, later converted to guanosine-5′-monophosphate. A novel non-genotoxic p53 activator Inauzhin (INZ) inhibits cellular activity of IMPDH2, which in turn reduces the levels of cellular GTP and GTP-binding nucleostemin. INZ also induces the ribosomal stress (RS)-p53 pathway and RPL11/RPL5-MDM2 interaction and activates p53 and inhibits cancer cell growth.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the C terminal region of human IMPDH2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :