Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti-CYTB antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.
Biochem/physiol Actions
Mitochondrially encoded cytochrome b (MT-CYB; CYTB) is a component of complex III mitochondrial respiratory chain. Mutations in CYTB are associated with hypertrophic cardiomyopathy and Leber′s hereditary optic neuropathy. CYTB is up-regulated in uterine leiomyomas compared with myometrium tissues. Homoplasmic alteration in CYTB has been associated with colorectal cancer. Mutation in CYTB is also detected in primary bladder cancer patient. Cleaved CYTB protein functions as cytoplasmic mediator of FAS-induced apoptosis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Mitochondrially encoded cytochrome b (MT-CYB; CYTB) is encoded by mitochondrial DNA.
Immunogen
Synthetic peptide directed towards the N terminal region of human CYTB
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :