Anti-CYTB

Code: av50256-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-CYTB antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

M...


 Read more

Your Price
$518.29 100UL

Not available outside of the UK & Ireland.

Application

Anti-CYTB antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

Mitochondrially encoded cytochrome b (MT-CYB; CYTB) is a component of complex III mitochondrial respiratory chain. Mutations in CYTB are associated with hypertrophic cardiomyopathy and Leber′s hereditary optic neuropathy. CYTB is up-regulated in uterine leiomyomas compared with myometrium tissues. Homoplasmic alteration in CYTB has been associated with colorectal cancer. Mutation in CYTB is also detected in primary bladder cancer patient. Cleaved CYTB protein functions as cytoplasmic mediator of FAS-induced apoptosis.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Mitochondrially encoded cytochrome b (MT-CYB; CYTB) is encoded by mitochondrial DNA.

Immunogen

Synthetic peptide directed towards the N terminal region of human CYTB

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MTCYB(4519)
mol wt42 kDa
NCBI accession no.NP_536855
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.