Anti-IFIT3

Code: av46034-100ul D2-231

Not available outside of the UK & Ireland.

Application

Anti-IFIT3 polyclonal antibody is used to tag interferon-induced protein with tetratricopeptide repeats 3 protein for detection and quantitation by Western blotti...


 Read more

Your Price
$457.71 100UL

Not available outside of the UK & Ireland.

Application

Anti-IFIT3 polyclonal antibody is used to tag interferon-induced protein with tetratricopeptide repeats 3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and level of interferon-induced protein with tetratricopeptide repeats 3 in cells responding to interferon induction such as occurs during RNA virus infection.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Interferon-induced protein with tetratricopeptide repeats 3 (IFIT3) is an interferon-stimulated gene induced by RNA virus infections, lipopolysaccharides and double-stranded RNA. IFIT3 and its family members (IFIT1, IFIT2, IFIT5) are involved in protein:protein interactions the a effect processes such as translation initiation, virus replication, cell migration, proliferation and ds-RNA signaling.

Immunogen

Synthetic peptide directed towards the N terminal region of human IFIT3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY

Specificity

Anti-IFIT3 polyclonal antibody reacts with human, mouse, bovine, and rat interferon-induced protein with tetratricopeptide repeats 3 proteins.

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... IFIT3(3437)
mol wt56 kDa
NCBI accession no.NP_001540
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.O14879
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.