Anti-TRIM10

Code: av34424-100ul D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-TRIM10 antibody can be used for western blot applications at a concentration of 5 µg/ml.

Biochem/physiol Actions

TRI...


 En savoir plus

Votre prix
$538.48 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-TRIM10 antibody can be used for western blot applications at a concentration of 5 µg/ml.

Biochem/physiol Actions

TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

TRIM10 is a tripartite motif-containing protein that localizes in the cytoplasm. It has also been implicated in the differentiation and survival of erythroid cells.Rabbit Anti-TRIM10 antibody recognizes human, mouse, bovine, and pig TRIM10.

Immunogen

Synthetic peptide directed towards the C terminal region of human TRIM10

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLSS

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TRIM10(10107)
mol wt55 kDa
NCBI accession no.NP_006769
Quality Level100
shipped inwet ice
species reactivityhuman
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9UDY6
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.