Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Rabbit Anti-TRIM10 antibody can be used for western blot applications at a concentration of 5 µg/ml.
Biochem/physiol Actions
TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
TRIM10 is a tripartite motif-containing protein that localizes in the cytoplasm. It has also been implicated in the differentiation and survival of erythroid cells.Rabbit Anti-TRIM10 antibody recognizes human, mouse, bovine, and pig TRIM10.
Immunogen
Synthetic peptide directed towards the C terminal region of human TRIM10
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLSS
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :