Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Rabbit Anti-BARHL2 antibody can be used for western blot applications at a concentration of 0.05-2.0µg/ml. It can also be used for IHC assays at 4-8µg/ml, using paraffin-embedded tissues.
Biochem/physiol Actions
BARHL2 and BARHL1 are two homeobox genes in mouse and human, which are highly related to the Bar Drosophila genes.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
BARHL2 is a homeobox transcription factor that regulates neuronal dI1 subtype diversification in the developing spinal cord.Rabbit Anti-BARHL2 antibody recognizes rat, human, and mouse BARHL2.
Immunogen
Synthetic peptide directed towards the middle region of human BARHL2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEG
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :