Anti-BARHL2

Code: AV31981-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-BARHL2 antibody can be used for western blot applications at a concentration of 0.05-2.0µg/ml. It can also be used for IHC assays at 4-8µg/m...


 En savoir plus

Votre prix
$611.17 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Rabbit Anti-BARHL2 antibody can be used for western blot applications at a concentration of 0.05-2.0µg/ml. It can also be used for IHC assays at 4-8µg/ml, using paraffin-embedded tissues.

Biochem/physiol Actions

BARHL2 and BARHL1 are two homeobox genes in mouse and human, which are highly related to the Bar Drosophila genes.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

BARHL2 is a homeobox transcription factor that regulates neuronal dI1 subtype diversification in the developing spinal cord.Rabbit Anti-BARHL2 antibody recognizes rat, human, and mouse BARHL2.

Immunogen

Synthetic peptide directed towards the middle region of human BARHL2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEG

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... BARHL2(343472)
mol wt42 kDa
NCBI accession no.NP_064447
Quality Level100
shipped inwet ice
species reactivityhuman, rat, horse, guinea pig
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q9NY43
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.