Non disponible en dehors du Royaume-Uni et de l'Irlande
Application
Anti-TCF4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 µg/ml.
Biochem/physiol Actions
TCF-4 mediates the transformation of epithelial cells of colon in the absence of APC gene expression. The expression of TCF-4 is required to establish the proliferative progenitors to form the crypts of embryonic small intestine. TCF-4 collaborates with β-catenin to regulate the colorectal transformation process. Lack of TCF-4 expression results in developmental delay and intellectual disability termed as Pitt-Hopkins syndrome.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
TCF-4 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway.
Immunogen
Synthetic peptide directed towards the N terminal region of human TCF4
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCH
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :