Anti-TCF4

Code: AV100776-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-TCF4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 µg/ml.

Biochem/physiol Actions...


 En savoir plus

Votre prix
$542.52 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-TCF4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 µg/ml.

Biochem/physiol Actions

TCF-4 mediates the transformation of epithelial cells of colon in the absence of APC gene expression. The expression of TCF-4 is required to establish the proliferative progenitors to form the crypts of embryonic small intestine. TCF-4 collaborates with β-catenin to regulate the colorectal transformation process. Lack of TCF-4 expression results in developmental delay and intellectual disability termed as Pitt-Hopkins syndrome.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

TCF-4 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway.

Immunogen

Synthetic peptide directed towards the N terminal region of human TCF4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCH

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... TCF4(6925)
mol wt71 kDa
NCBI accession no.NP_001077431
Quality Level100
shipped inwet ice
species reactivityhuman, horse, pig, mouse, rat
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P15884
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.