Non disponible en dehors du Royaume-Uni et de l'Irlande
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
LIN54 is a component of the LIN, or DREAM, complex, an essential regulator of cell cycle genes.
Immunogen
Synthetic peptide directed towards the C-terminal region of Human LIN54
Physical form
Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide
Sequence
Synthetic peptide located within the following region: TFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINS
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :