Anticorps ANTI-MAPK1 (C - TERMINAL)

Code: SAB2109108-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


 En savoir plus

Votre prix
$494.06 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.

Immunogen

Synthetic peptide directed towards the C terminal region of human MAPK1

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: PYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... MAPK1(57396)
mol wt41 kDa
NCBI accession no.NM_138957
shipped inwet ice
species reactivity (predicted by homology)horse, canine, bovine, zebrafish, goat, rabbit, mouse, human, guinea pig
species reactivityrat
storage temp.−20°C
technique(s)immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 µg/mL, western blot: 1 µg/mL
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.