Anticorps ANTI - SLC9A3 produit en lapin

Non disponible en dehors du Royaume-Uni et de l'Irlande

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

SLC9A3 is involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. SLC9A3 is the major proton extruding system driven by the inward sodium ion chemical gradient. SLC9A3 plays an important role in signal transduction.

Immunogen

Synthetic peptide directed towards the middle region of human SLC9A3

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR