ANTI-MS4A3 (N-TERMINAL) ANTIBODY PRODUCE

Code: sab2108917-100ul D2-231

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


 Read more

Your Price
$525.62 100UL

Not available outside of the UK & Ireland.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described.

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: AGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQ

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateperoxidase conjugate
formbuffered aqueous solution
Gene Informationhuman ... MS4A3(932)
mol wt24 kDa
NCBI accession no.NM_006138
shipped inwet ice
species reactivity (predicted by homology)human
storage temp.−20°C
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.