ANTI-HMGB1

Code: SAB2108675-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

HMGB1 belongs to the HMGB family. It contains 2 HMG box DNA-binding domains. The protein binds preferentially single-stranded DNA and unwinds double s...


 En savoir plus

Votre prix
$518.29 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

HMGB1 belongs to the HMGB family. It contains 2 HMG box DNA-binding domains. The protein binds preferentially single-stranded DNA and unwinds double stranded DNA. The oxidized HMGB1 may accumulate even in cells under oxidative stress.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human HMGB1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKT

accession no.NM_002128
antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... HMGB1(3146)
mol wt25 kDa
Quality Level100
shipped inwet ice
species reactivityrabbit, rat, dog, human, guinea pig, horse, mouse, bovine
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.P09429
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.