Non disponible en dehors du Royaume-Uni et de l'Irlande
Biochem/physiol Actions
Glutaminase 2 (GLS2) is a mitochondrial phosphate-activated glutaminase that catalyses the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.GLS2 functions as a tumor protein p53 downstream target gene. GLS2 controls the functions of p53, in modulating energy metabolism and antioxidant defense. It might play a critical role in tumorigenesis. The protein negatively controls PI3K (phosphatidylinositol 3-kinase) /AKT (non-specific serine/threonine protein kinase) signalling pathway. GLS2 regulates the neuronal effects of tumor protein p73. The protein might have a pivotal role in radioresistance in cervical cancer patients.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Glutaminase 2 (GLS2) is located in mitochondria and nucleus. The gene is located on human chromosome 12q13. GLS2 protein is expressed in brain, pancreas, cancer cells and cells of the immune system.
Immunogen
Synthetic peptide directed towards the middle region of human GLS2
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :