ANTI-FAM107A

Code: SAB2108568-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-FAM107A has been used in the quantification of DRR1 protein levels.

Biochem/physiol Actions

FAM107A (family with sequence simila...


 En savoir plus

Votre prix
$455.72 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Application

Anti-FAM107A has been used in the quantification of DRR1 protein levels.

Biochem/physiol Actions

FAM107A (family with sequence similarity 107 member A) participates in neuronal cell survival. Overexpression of FAM107A has the ability to repress the development of tumor cells. It plays a major role in the progression of the embryo. FAM107A participates in cell invasion. This protein modulates FA dynamics and cell movement.When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

FAM107A (family with sequence similarity 107 member A) is expressed at high level in the brain and heart. It has a nuclear localization signal (NLS) and a coiled domain. FAM107A has 144 amino acids and is located on human chromosome 3p14.3.

Immunogen

Synthetic peptide directed towards the middle region of human FAM107A

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE

accession no.NM_007177
antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... FAM107A(11170)
mol wt17 kDa
Quality Level100
shipped inwet ice
species reactivityguinea pig, mouse, human, bovine, dog, rat
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.O95990
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.