ANTI-SCN3B

Code: SAB2108512-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of ...


 En savoir plus

Votre prix
$518.29 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SCN3B

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND

accession no.NM_018400
antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SCN3B(55800)
mol wt24 kDa
Quality Level100
shipped inwet ice
species reactivitybovine, human, horse, mouse, rat, rabbit
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.Q9NY72
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.