ANTI-GSR

Code: SAB2108147-100UL D2-231

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both g...


 En savoir plus

Votre prix
$557.33 100UL

Non disponible en dehors du Royaume-Uni et de l'Irlande

Biochem/physiol Actions

GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human GSR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GSR(2936)
mol wt56kDa
NCBI accession no.NM_000637
Quality Level100
shipped inwet ice
species reactivityhuman, mouse, guinea pig, rabbit
storage temp.−20°C
technique(s)immunoblotting: suitable, immunohistochemistry: suitable
UniProt accession no.P00390
Ce produit répond aux critères suivants pour être admissible aux récompenses suivantes :



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.